PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC434_p6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 163aa    MW: 18892.2 Da    PI: 9.4427
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC434_p6genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.21.9e-202485157
               TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox  1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
               ++ R+++t eql++L +lF+   r+p+++++++++++l    +++ ++V++WFqN++a+e++
  RrC434_p6 24 KCGRWNPTVEQLKVLTDLFRAgLRTPTTDQIQKISTELsfygKIESKNVFYWFQNHKARERQ 85
               568*****************99**************************************97 PP

2Wus_type_Homeobox113.69.7e-372487265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       ++ RW+Pt eQ+k+L++l+++GlrtP++++iq+i++eL+ yGkie+kNVfyWFQN+kaRerqk+
          RrC434_p6 24 KCGRWNPTVEQLKVLTDLFRAGLRTPTTDQIQKISTELSFYGKIESKNVFYWFQNHKARERQKR 87
                       678***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.6732186IPR001356Homeobox domain
SMARTSM003897.8E-42390IPR001356Homeobox domain
PfamPF000461.8E-172585IPR001356Homeobox domain
SuperFamilySSF466893.38E-112688IPR009057Homeodomain-like
CDDcd000860.001152787No hitNo description
Gene3DG3DSA:1.10.10.607.0E-82785IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0010078Biological Processmaintenance of root meristem identity
GO:1902459Biological Processpositive regulation of stem cell population maintenance
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MSFPLKVRSV RGNNGGGGGG TGTKCGRWNP TVEQLKVLTD LFRAGLRTPT TDQIQKISTE  60
LSFYGKIESK NVFYWFQNHK ARERQKRHVF EINEDEEERV IETLQLFPVN SFQESKVDKI  120
RSRGHNQYRE YIRETNTTTF PSYSSCGAEM EHPSPLELRL NFL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF6017691e-144KF601769.1 Raphanus sativus WUSCHEL-related homeobox 5 (WOX5) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013640167.16e-96PREDICTED: WUSCHEL-related homeobox 5
SwissprotQ8H1D21e-92WOX5_ARATH; WUSCHEL-related homeobox 5
TrEMBLV5RE091e-101V5RE09_RAPSA; WUSCHEL-related homeobox 5
STRINGAT3G11260.13e-90(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40142857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11260.11e-77WUSCHEL related homeobox 5